Lineage for d1apz.1 (1apz A:,B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995809Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
    automatically mapped to Pfam PF01112
  6. 2995810Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 2995841Species Human (Homo sapiens) [TaxId:9606] [56263] (2 PDB entries)
  8. 2995844Domain d1apz.1: 1apz A:,B: [42006]
    complexed with asp, nag

Details for d1apz.1

PDB Entry: 1apz (more details), 2.3 Å

PDB Description: human aspartylglucosaminidase complex with reaction product
PDB Compounds: (A:) aspartylglucosaminidase, (B:) aspartylglucosaminidase

SCOPe Domain Sequences for d1apz.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1apz.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Human (Homo sapiens) [TaxId: 9606]}
splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge
ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine
dlstsasqalhsdwlarncqpnywrnvipdpskycgpykppXtigmvvihktghiaagts
tngikfkihgrvgdspipgagayaddtagaaaatgngdilmrflpsyqaveymrrgedpt
iacqkvisriqkhfpeffgavicanvtgsygaacnklstftqfsfmvynseknqpteekv
dci

SCOPe Domain Coordinates for d1apz.1:

Click to download the PDB-style file with coordinates for d1apz.1.
(The format of our PDB-style files is described here.)

Timeline for d1apz.1: