SCOPe 2.08: Domain d1apz.1: 1apz A:,B:

Lineage for d1apz.1 (1apz A:,B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
   automatically mapped to Pfam PF01112

6. Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
   the precursor chain is cleaved onto 2 fragments by autoproteolysis

7. Species Human (Homo sapiens) [TaxId:9606] [56263] (2 PDB entries)

8. Domain d1apz.1: 1apz A:,B: [42006]
   complexed with asp, nag

Details for d1apz.1

PDB Entry: 1apz, 2.3 Å

PDB Description: human aspartylglucosaminidase complex with reaction product

PDB Compounds: (A:) aspartylglucosaminidase, (B:) aspartylglucosaminidase

SCOPe Domain Sequences for d1apz.1:

Sequence; same for both SEQRES and ATOM records:

>g1apz.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Human (Homo sapiens) [TaxId: 9606]}
splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge
ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine
dlstsasqalhsdwlarncqpnywrnvipdpskycgpykppXtigmvvihktghiaagts
tngikfkihgrvgdspipgagayaddtagaaaatgngdilmrflpsyqaveymrrgedpt
iacqkvisriqkhfpeffgavicanvtgsygaacnklstftqfsfmvynseknqpteekv
dci

Timeline for d1apz.1:

• d1apz.1 first appeared (with stable ids) in SCOP 1.55
  
• d1apz.1 appears in SCOPe 2.07