PDB entry 1apz

View 1apz on RCSB PDB site
Description: human aspartylglucosaminidase complex with reaction product
Class: complex (hydrolase/peptide)
Keywords: ASPARTYLGLUCOSAMINIDASE, GLYCOSYLASPARAGINASE, COMPLEX (HYDROLASE-PEPTIDE), COMPLEX (HYDROLASE-PEPTIDE) complex
Deposited on 1995-06-14, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartylglucosaminidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apz.1
  • Chain 'B':
    Compound: aspartylglucosaminidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apz.1
  • Chain 'C':
    Compound: aspartylglucosaminidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apz.2
  • Chain 'D':
    Compound: aspartylglucosaminidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apz.2
  • Heterogens: NAG, ASP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1apzA (A:)
    ssplplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelg
    ettldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfin
    edlstsasqalhsdwlarncqpnywrnvipdpskycgpykpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1apzA (A:)
    splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge
    ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine
    dlstsasqalhsdwlarncqpnywrnvipdpskycgpykpp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apzB (B:)
    tigmvvihktghiaagtstngikfkihgrvgdspipgagayaddtagaaaatgngdilmr
    flpsyqaveymrrgedptiacqkvisriqkhfpeffgavicanvtgsygaacnklstftq
    fsfmvynseknqpteekvdci
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1apzC (C:)
    ssplplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelg
    ettldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfin
    edlstsasqalhsdwlarncqpnywrnvipdpskycgpykpp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1apzC (C:)
    splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge
    ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine
    dlstsasqalhsdwlarncqpnywrnvipdpskycgpykpp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apzD (D:)
    tigmvvihktghiaagtstngikfkihgrvgdspipgagayaddtagaaaatgngdilmr
    flpsyqaveymrrgedptiacqkvisriqkhfpeffgavicanvtgsygaacnklstftq
    fsfmvynseknqpteekvdci