Lineage for d1pmas_ (1pma S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36770Protein Proteasome beta subunit (catalytic) [56252] (2 species)
  7. 36814Species Thermoplasma acidophilum [TaxId:2303] [56253] (1 PDB entry)
  8. 36821Domain d1pmas_: 1pma S: [41866]
    Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_

Details for d1pmas_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum

SCOP Domain Sequences for d1pmas_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmas_ d.153.1.4 (S:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOP Domain Coordinates for d1pmas_:

Click to download the PDB-style file with coordinates for d1pmas_.
(The format of our PDB-style files is described here.)

Timeline for d1pmas_: