Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (2 species) |
Species Thermoplasma acidophilum [TaxId:2303] [56253] (1 PDB entry) |
Domain d1pmar_: 1pma R: [41865] Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_ |
PDB Entry: 1pma (more details), 3.4 Å
SCOP Domain Sequences for d1pmar_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmar_ d.153.1.4 (R:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d1pmar_:
View in 3D Domains from other chains: (mouse over for more information) d1pma1_, d1pma2_, d1pmaa_, d1pmab_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_, d1pmap_, d1pmaq_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_ |