Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.145: FAD-binding domain [56175] (1 superfamily) |
Superfamily d.145.1: FAD-binding domain [56176] (3 families) |
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (3 proteins) |
Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species) |
Species Pseudomonas putida [TaxId:303] [56181] (2 PDB entries) |
Domain d1diib2: 1dii B:7-242 [41745] Other proteins in same PDB: d1diia1, d1diib1, d1diic_, d1diid_ |
PDB Entry: 1dii (more details), 2.5 Å
SCOP Domain Sequences for d1diib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diib2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida} avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1diib2:
View in 3D Domains from other chains: (mouse over for more information) d1diia1, d1diia2, d1diic_, d1diid_ |