SCOPe 2.08: Domain d1diib2: 1dii B:7-242

Lineage for d1diib2 (1dii B:7-242)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
   the other subunit is a short-chain cytochrome c
7. Species Pseudomonas putida [TaxId:303] [56181] (2 PDB entries)

8. Domain d1diib2: 1dii B:7-242 [41745]
   Other proteins in same PDB: d1diia1, d1diib1, d1diic_, d1diid_
   complexed with cl, fad, hec

Details for d1diib2

PDB Entry: 1dii, 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

PDB Compounds: (B:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diib2:

Sequence; same for both SEQRES and ATOM records:

>d1diib2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

Timeline for d1diib2:

• d1diib2 first appeared (with stable ids) in SCOP 1.55
  
• d1diib2 appears in SCOPe 2.07