SCOP 1.57: Domain d1fjgh_: 1fjg H:

Lineage for d1fjgh_ (1fjg H:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)

4. Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family)

5. Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)

6. Protein Ribosomal protein S8 [56049] (3 species)

7. Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries)

8. Domain d1fjgh_: 1fjg H: [41468]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgh_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgh_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1fjgh_:

• d1fjgh_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgh_ appears in SCOP 1.59
  
• d1fjgh_ appears in the current release, SCOPe 2.08