SCOP 1.57: Domain d1fjgb_: 1fjg B:

Lineage for d1fjgb_ (1fjg B:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (1 species)

7. Species Thermus thermophilus [TaxId:274] [52316] (10 PDB entries)

8. Domain d1fjgb_: 1fjg B: [31400]
   Other proteins in same PDB: d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgb_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgb_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvqeae

Timeline for d1fjgb_:

• d1fjgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgb_ appears in SCOP 1.59
  
• d1fjgb_ appears in the current release, SCOPe 2.08