SCOP 1.57: Domain d1fjgs_: 1fjg S:

Lineage for d1fjgs_ (1fjg S:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)

8. Domain d1fjgs_: 1fjg S: [38451]
   Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgt_, d1fjgv_

Details for d1fjgs_

PDB Entry: 1fjg, 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgs_:

Sequence; same for both SEQRES and ATOM records:

>d1fjgs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyrghgk

Timeline for d1fjgs_:

• d1fjgs_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjgs_ appears in SCOP 1.59
  
• d1fjgs_ appears in the current release, SCOPe 2.08