Lineage for d1fjgo_ (1fjg O:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46191Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 46192Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 46199Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 46200Protein Ribosomal protein S15 [47065] (2 species)
  7. 46203Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)
  8. 46207Domain d1fjgo_: 1fjg O: [16388]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_

Details for d1fjgo_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1fjgo_:

Click to download the PDB-style file with coordinates for d1fjgo_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgo_: