| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() |
| Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
| Protein Ribosomal protein S3 C-terminal domain [54823] (1 species) |
| Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries) |
| Domain d1fjgc2: 1fjg C:107-207 [38839] Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_ |
PDB Entry: 1fjg (more details), 3 Å
SCOP Domain Sequences for d1fjgc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjgc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1fjgc2: