![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.138: B3/B4 domain of PheRS, PheT [56036] (1 superfamily) |
![]() | Superfamily d.138.1: B3/B4 domain of PheRS, PheT [56037] (1 family) ![]() |
![]() | Family d.138.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein) |
![]() | Protein B3/B4 domain of PheRS, PheT [56039] (1 species) |
![]() | Species Thermus thermophilus (Thermus aquaticus) [56040] (4 PDB entries) |
![]() | Domain d1b70b6: 1b70 B:191-399 [41457] Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5 |
PDB Entry: 1b70 (more details), 2.7 Å
SCOP Domain Sequences for d1b70b6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b70b6 d.138.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus (Thermus aquaticus)} lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv paqrralsllqalagarvaealleagspk
Timeline for d1b70b6: