SCOPe 2.08: Domain d1b70b6: 1b70 B:191-399

Lineage for d1b70b6 (1b70 B:191-399)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.153: PheT/TilS domain [56036] (1 superfamily)
   core: 3 layers; contains beta-sandwich of unusual topology

4. Superfamily b.153.1: PheT/TilS domain [56037] (2 families)
   contains putative tRNA-binding structural motif

5. Family b.153.1.1: B3/B4 domain of PheRS, PheT [56038] (1 protein)
   Pfam PF03483; decorated with additional structures

6. Protein B3/B4 domain of PheRS, PheT [56039] (1 species)

7. Species Thermus thermophilus [TaxId:274] [56040] (12 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1b70b6: 1b70 B:191-399 [41457]
   Other proteins in same PDB: d1b70a_, d1b70b1, d1b70b2, d1b70b3, d1b70b4, d1b70b5
   protein/RNA complex; complexed with mg, phe

Details for d1b70b6

PDB Entry: 1b70, 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1b70b6:

Sequence; same for both SEQRES and ATOM records:

>d1b70b6 b.153.1.1 (B:191-399) B3/B4 domain of PheRS, PheT {Thermus thermophilus [TaxId: 274]}
lkaealplpfalkvedpegaphftlgyafglrvapsplwmqralfaagmrpinnvvdvtn
yvmleraqpmhafdlrfvgegiavrraregerlktldgvertlhpedlviagwrgeesfp
lglagvmggaesevredteaialevacfdpvsirktarrhglrteashrfergvdplgqv
paqrralsllqalagarvaealleagspk

Timeline for d1b70b6:

• d1b70b6 first appeared (with stable ids) in SCOP 1.55
  
• d1b70b6 appears in SCOPe 2.07