Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Norovirus hu/gii.4/sydney/nsw0514/2012/au [TaxId:1241973] [419916] (10 PDB entries) |
Domain d4x0cb1: 4x0c B:225-530 [414470] Other proteins in same PDB: d4x0cb2 automated match to d5or7a_ complexed with edo, fmt |
PDB Entry: 4x0c (more details), 1.72 Å
SCOPe Domain Sequences for d4x0cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x0cb1 b.121.4.0 (B:225-530) automated matches {Norovirus hu/gii.4/sydney/nsw0514/2012/au [TaxId: 1241973]} kpfsvpvltveemtnsrfpipleklftgpssafvvqpqngrcttdgvllgttqlspvnic tfrgdvthitgsrnytmnlasqnwndydpteeipaplgtpdfvgkiqgvltqttrtdgst rghkatvytgsadfapklgrvqfetdtdrdfeanqntkftpvgviqdggtthrnepqqwv lpsysgrnthnvhlapavaptfpgeqllffrstmpgcsgypnmdldcllpqewvqyfyqe aapaqsdvallrfvnpdtgrvlfecklhksgyvtvahtgqhdlvippngyfrfdswvnqf ytlapm
Timeline for d4x0cb1: