Lineage for d1ge8a2 (1ge8 A:126-247)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262319Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 262320Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 262339Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins)
    duplication: consists of two domains of this fold
  6. 262361Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species)
  7. 262362Species Archaeon Pyrococcus furiosus [TaxId:2261] [55992] (2 PDB entries)
  8. 262364Domain d1ge8a2: 1ge8 A:126-247 [41399]
    mutant

Details for d1ge8a2

PDB Entry: 1ge8 (more details), 2.1 Å

PDB Description: proliferating cell nuclear antigen (pcna) homolog from pyrococcus furiosus

SCOP Domain Sequences for d1ge8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge8a2 d.131.1.2 (A:126-247) Prolifirating cell nuclear antigen (PCNA) {Archaeon Pyrococcus furiosus}
pelpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
rv

SCOP Domain Coordinates for d1ge8a2:

Click to download the PDB-style file with coordinates for d1ge8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ge8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ge8a1