SCOPe 2.08: Domain d1ge8a2: 1ge8 A:126-247

Lineage for d1ge8a2 (1ge8 A:126-247)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries)

8. Domain d1ge8a2: 1ge8 A:126-247 [41399]

Details for d1ge8a2

PDB Entry: 1ge8, 2.1 Å

PDB Description: proliferating cell nuclear antigen (pcna) homolog from pyrococcus furiosus

PDB Compounds: (A:) proliferation cell nuclear antigen

SCOPe Domain Sequences for d1ge8a2:

Sequence; same for both SEQRES and ATOM records:

>d1ge8a2 d.131.1.2 (A:126-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pelpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
rv

Timeline for d1ge8a2:

• d1ge8a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ge8a2 appears in SCOPe 2.07