Lineage for d1ge8a2 (1ge8 A:126-247)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977154Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries)
  8. 2977160Domain d1ge8a2: 1ge8 A:126-247 [41399]

Details for d1ge8a2

PDB Entry: 1ge8 (more details), 2.1 Å

PDB Description: proliferating cell nuclear antigen (pcna) homolog from pyrococcus furiosus
PDB Compounds: (A:) proliferation cell nuclear antigen

SCOPe Domain Sequences for d1ge8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ge8a2 d.131.1.2 (A:126-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pelpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
rv

SCOPe Domain Coordinates for d1ge8a2:

Click to download the PDB-style file with coordinates for d1ge8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ge8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ge8a1