Lineage for d1ge8a2 (1ge8 A:126-247)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily) Superfamily d.131.1: DNA clamp [55979] (2 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) 
Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species) Species Archaea (Pyrococcus furiosus) [TaxId:2261] [55992] (1 PDB entry) 
Domain d1ge8a2: 1ge8 A:126-247 [41399]
Details for d1ge8a2
PDB Entry: 1ge8 (more details), 2.1 Å
PDB Description: proliferating cell nuclear antigen (pcna) homolog from pyrococcus furiosus
SCOP Domain Sequences for d1ge8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge8a2 d.131.1.2 (A:126-247) Prolifirating cell nuclear antigen (PCNA) {Archaea (Pyrococcus furiosus)}
pelpftakvvvlgevlkdavkdaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
rv
SCOP Domain Coordinates for d1ge8a2:
Click to download the PDB-style file with coordinates for d1ge8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ge8a2:
- d1ge8a2 appears in SCOP 1.57
- d1ge8a2 appears in the current release, SCOPe 2.08
View in 3D
