SCOP 1.57: Domain d1lxtb4: 1lxt B:421-561

Lineage for d1lxtb4 (1lxt B:421-561)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.129: TBP-like [55944] (4 superfamilies)

4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family)

5. Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (1 protein)

6. Protein Phosphoglucomutase, C-terminal domain [55959] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)

8. Domain d1lxtb4: 1lxt B:421-561 [41310]
   Other proteins in same PDB: d1lxta1, d1lxta2, d1lxta3, d1lxtb1, d1lxtb2, d1lxtb3

Details for d1lxtb4

PDB Entry: 1lxt, 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit

SCOP Domain Sequences for d1lxtb4:

Sequence; same for both SEQRES and ATOM records:

>d1lxtb4 d.129.2.1 (B:421-561) Phosphoglucomutase, C-terminal domain {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Timeline for d1lxtb4:

• d1lxtb4 first appeared (with stable ids) in SCOP 1.55
  
• d1lxtb4 appears in SCOP 1.59
  
• d1lxtb4 appears in the current release, SCOPe 2.08