Lineage for d1lxtb4 (1lxt B:421-561)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137429Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 137535Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
  5. 137536Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (2 proteins)
  6. 137543Protein Phosphoglucomutase [55959] (1 species)
  7. 137544Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 137554Domain d1lxtb4: 1lxt B:421-561 [41310]
    Other proteins in same PDB: d1lxta1, d1lxta2, d1lxta3, d1lxtb1, d1lxtb2, d1lxtb3

Details for d1lxtb4

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit

SCOP Domain Sequences for d1lxtb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxtb4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOP Domain Coordinates for d1lxtb4:

Click to download the PDB-style file with coordinates for d1lxtb4.
(The format of our PDB-style files is described here.)

Timeline for d1lxtb4: