Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.129: TBP-like [55944] (3 superfamilies) |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) |
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (1 protein) |
Protein Phosphoglucomutase, C-terminal domain [55959] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) |
Domain d1lxtb4: 1lxt B:421-561 [41310] Other proteins in same PDB: d1lxta1, d1lxta2, d1lxta3, d1lxtb1, d1lxtb2, d1lxtb3 |
PDB Entry: 1lxt (more details), 2.7 Å
SCOP Domain Sequences for d1lxtb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxtb4 d.129.2.1 (B:421-561) Phosphoglucomutase, C-terminal domain {Rabbit (Oryctolagus cuniculus)} rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d1lxtb4:
View in 3D Domains from other chains: (mouse over for more information) d1lxta1, d1lxta2, d1lxta3, d1lxta4 |