SCOP 1.57: Domain d1lxtb2: 1lxt B:191-303

Lineage for d1lxtb2 (1lxt B:191-303)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein)

6. Protein Phosphoglucomutase, first 3 domains [53740] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)

8. Domain d1lxtb2: 1lxt B:191-303 [35436]
   Other proteins in same PDB: d1lxta4, d1lxtb4

Details for d1lxtb2

PDB Entry: 1lxt, 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit

SCOP Domain Sequences for d1lxtb2:

Sequence; same for both SEQRES and ATOM records:

>d1lxtb2 c.84.1.1 (B:191-303) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

Timeline for d1lxtb2:

• d1lxtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1lxtb2 appears in SCOP 1.59
  
• d1lxtb2 appears in the current release, SCOPe 2.08