Lineage for d1lxtb4 (1lxt B:421-561)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975429Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2975430Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2975440Protein Phosphoglucomutase [55959] (1 species)
  7. 2975441Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries)
  8. 2975447Domain d1lxtb4: 1lxt B:421-561 [41310]
    Other proteins in same PDB: d1lxta1, d1lxta2, d1lxta3, d1lxtb1, d1lxtb2, d1lxtb3
    complexed with cd, so4

Details for d1lxtb4

PDB Entry: 1lxt (more details), 2.7 Å

PDB Description: structure of phosphotransferase phosphoglucomutase from rabbit
PDB Compounds: (B:) phosphoglucomutase (dephospho form)

SCOPe Domain Sequences for d1lxtb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxtb4 d.129.2.1 (B:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d1lxtb4:

Click to download the PDB-style file with coordinates for d1lxtb4.
(The format of our PDB-style files is described here.)

Timeline for d1lxtb4: