Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
Protein Alpha-xylosidase [419128] (1 species) |
Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419649] (3 PDB entries) |
Domain d2xvla4: 2xvl A:789-870 [413032] Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla3, d2xvla5 automated match to d2xvga4 complexed with cl, ni, pxn, so4 |
PDB Entry: 2xvl (more details), 2.3 Å
SCOPe Domain Sequences for d2xvla4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvla4 b.71.1.4 (A:789-870) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} timrglvmdfpndrkawdintqymfgpaflvnpvyeykarsrdvylpagsdwynfytgek laggqtitadaplarvplfvka
Timeline for d2xvla4:
View in 3D Domains from same chain: (mouse over for more information) d2xvla1, d2xvla2, d2xvla3, d2xvla5 |