Lineage for d2xvla4 (2xvl A:789-870)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810904Protein Alpha-xylosidase [419128] (1 species)
  7. 2810905Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419649] (3 PDB entries)
  8. 2810906Domain d2xvla4: 2xvl A:789-870 [413032]
    Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla3, d2xvla5
    automated match to d2xvga4
    complexed with cl, ni, pxn, so4

Details for d2xvla4

PDB Entry: 2xvl (more details), 2.3 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh)
PDB Compounds: (A:) alpha-xylosidase, putative, xyl31a

SCOPe Domain Sequences for d2xvla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvla4 b.71.1.4 (A:789-870) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
timrglvmdfpndrkawdintqymfgpaflvnpvyeykarsrdvylpagsdwynfytgek
laggqtitadaplarvplfvka

SCOPe Domain Coordinates for d2xvla4:

Click to download the PDB-style file with coordinates for d2xvla4.
(The format of our PDB-style files is described here.)

Timeline for d2xvla4:

  • d2xvla4 is new in SCOPe 2.08-stable