Lineage for d2xvla5 (2xvl A:871-988)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825025Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2825026Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2825027Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (4 proteins)
  6. 2825028Protein Alpha-xylosidase, C-terminal domain [419129] (1 species)
    Pfam PF17137
  7. 2825029Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419651] (3 PDB entries)
  8. 2825030Domain d2xvla5: 2xvl A:871-988 [413033]
    Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla3, d2xvla4
    automated match to d2xvga5
    complexed with cl, ni, pxn, so4

Details for d2xvla5

PDB Entry: 2xvl (more details), 2.3 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh)
PDB Compounds: (A:) alpha-xylosidase, putative, xyl31a

SCOPe Domain Sequences for d2xvla5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvla5 b.150.1.1 (A:871-988) Alpha-xylosidase, C-terminal domain {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
gaivptgpliqhvdeglnspllitvytgangsfdiyeddgrslkyqqgewsriplsyddv
tgtliigdrvgsftgmadernirvrfiagptadatnfdkaaaeavtytgksvsikrpr

SCOPe Domain Coordinates for d2xvla5:

Click to download the PDB-style file with coordinates for d2xvla5.
(The format of our PDB-style files is described here.)

Timeline for d2xvla5:

  • d2xvla5 is new in SCOPe 2.08-stable