![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
![]() | Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) ![]() |
![]() | Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (4 proteins) |
![]() | Protein Alpha-xylosidase, C-terminal domain [419129] (1 species) Pfam PF17137 |
![]() | Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419651] (3 PDB entries) |
![]() | Domain d2xvla5: 2xvl A:871-988 [413033] Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla3, d2xvla4 automated match to d2xvga5 complexed with cl, ni, pxn, so4 |
PDB Entry: 2xvl (more details), 2.3 Å
SCOPe Domain Sequences for d2xvla5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvla5 b.150.1.1 (A:871-988) Alpha-xylosidase, C-terminal domain {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} gaivptgpliqhvdeglnspllitvytgangsfdiyeddgrslkyqqgewsriplsyddv tgtliigdrvgsftgmadernirvrfiagptadatnfdkaaaeavtytgksvsikrpr
Timeline for d2xvla5:
![]() Domains from same chain: (mouse over for more information) d2xvla1, d2xvla2, d2xvla3, d2xvla4 |