Lineage for d2xvla2 (2xvl A:238-386)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825681Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2825682Superfamily b.179.1: PA14-like [254123] (4 families) (S)
  5. 2825750Family b.179.1.3: Glycoside hydrolase family 31 (GH31), PA14-like domain [418815] (1 protein)
  6. 2825751Protein Alpha-xylosidase [419126] (1 species)
  7. 2825752Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419644] (3 PDB entries)
  8. 2825753Domain d2xvla2: 2xvl A:238-386 [413030]
    Other proteins in same PDB: d2xvla1, d2xvla3, d2xvla4, d2xvla5
    automated match to d2xvga2
    complexed with cl, ni, pxn, so4

Details for d2xvla2

PDB Entry: 2xvl (more details), 2.3 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh)
PDB Compounds: (A:) alpha-xylosidase, putative, xyl31a

SCOPe Domain Sequences for d2xvla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvla2 b.179.1.3 (A:238-386) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
aqplnqslklydaegkeggltvryfvgdelkltrveadfnhqfykqgnelenpfpeevag
ayknntlrielegsieaqatgkhqfkmynsgyaqlsldgevvldrwrmnwnpwyhnfyre
lnagdkhklkvswkpdggffhlrhldplp

SCOPe Domain Coordinates for d2xvla2:

Click to download the PDB-style file with coordinates for d2xvla2.
(The format of our PDB-style files is described here.)

Timeline for d2xvla2:

  • d2xvla2 is new in SCOPe 2.08-stable