Lineage for d2xvla1 (2xvl A:45-237,A:387-412)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782059Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins)
    Pfam PF16863
  6. 2782063Protein Alpha-xylosidase [419125] (1 species)
  7. 2782064Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419643] (3 PDB entries)
  8. 2782065Domain d2xvla1: 2xvl A:45-237,A:387-412 [413029]
    Other proteins in same PDB: d2xvla2, d2xvla3, d2xvla4, d2xvla5
    automated match to d2xvga1
    complexed with cl, ni, pxn, so4

Details for d2xvla1

PDB Entry: 2xvl (more details), 2.3 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh)
PDB Compounds: (A:) alpha-xylosidase, putative, xyl31a

SCOPe Domain Sequences for d2xvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvla1 b.30.5.11 (A:45-237,A:387-412) Alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
alaqvertaegvvltlpegtvkklrlqvmgeriirvtalpgtdfgivpesiqvvakpatn
vpfsvdqageklvlktsqvsaevslldgtvsfrdakgnvllqeenrgtfspvihdpdpvd
adsyalrqefnrgsdegffglgqhqngqvnyagenvelttynlvisipflvssrnygllw
dnnsitrfgdpreXaneqhelslasetgkaidyyfvagdt

SCOPe Domain Coordinates for d2xvla1:

Click to download the PDB-style file with coordinates for d2xvla1.
(The format of our PDB-style files is described here.)

Timeline for d2xvla1:

  • d2xvla1 is new in SCOPe 2.08-stable