Lineage for d2xvla3 (2xvl A:413-788)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832243Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins)
    Pfam PF01055
  6. 2832247Protein Catalytic domain of alpha-xylosidase [419127] (1 species)
  7. 2832248Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419647] (3 PDB entries)
  8. 2832249Domain d2xvla3: 2xvl A:413-788 [413031]
    Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla4, d2xvla5
    automated match to d2xvga3
    complexed with cl, ni, pxn, so4

Details for d2xvla3

PDB Entry: 2xvl (more details), 2.3 Å

PDB Description: crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus in complex with pentaerythritol propoxylate (5 4 po oh)
PDB Compounds: (A:) alpha-xylosidase, putative, xyl31a

SCOPe Domain Sequences for d2xvla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvla3 c.1.8.13 (A:413-788) Catalytic domain of alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
kddiisgyrqltgksvmlpkwaygfwqsrerykssdeiiqnlkeyrdrkipidnivldws
ywpedawgshdfdkqffpdpkalvdkvhamnaqimisvwpkfypttdnykelnakgfmfn
rnldeknldwigkgylnafydpfspeataifwkqirdkinvhgfdawwldavepdihsnl
tfekrkwlmtpnargngaeifnayavphaegvyqgelatdgdkrsfiltrsgfggiqrtg
saiwsgdivsrwsdmkdqiaagigtnlagvtnwtfdiggftpedrfrhgkkgfvgswtal
daeqvdewqelntrwyqfgafvplyrshgqnpyreifniadegtevynamvwytklryyl
mpyiytlggdtyhkdg

SCOPe Domain Coordinates for d2xvla3:

Click to download the PDB-style file with coordinates for d2xvla3.
(The format of our PDB-style files is described here.)

Timeline for d2xvla3:

  • d2xvla3 is new in SCOPe 2.08-stable