![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (6 proteins) Pfam PF01055 |
![]() | Protein Catalytic domain of alpha-xylosidase [419127] (1 species) |
![]() | Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [419647] (3 PDB entries) |
![]() | Domain d2xvla3: 2xvl A:413-788 [413031] Other proteins in same PDB: d2xvla1, d2xvla2, d2xvla4, d2xvla5 automated match to d2xvga3 complexed with cl, ni, pxn, so4 |
PDB Entry: 2xvl (more details), 2.3 Å
SCOPe Domain Sequences for d2xvla3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvla3 c.1.8.13 (A:413-788) Catalytic domain of alpha-xylosidase {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} kddiisgyrqltgksvmlpkwaygfwqsrerykssdeiiqnlkeyrdrkipidnivldws ywpedawgshdfdkqffpdpkalvdkvhamnaqimisvwpkfypttdnykelnakgfmfn rnldeknldwigkgylnafydpfspeataifwkqirdkinvhgfdawwldavepdihsnl tfekrkwlmtpnargngaeifnayavphaegvyqgelatdgdkrsfiltrsgfggiqrtg saiwsgdivsrwsdmkdqiaagigtnlagvtnwtfdiggftpedrfrhgkkgfvgswtal daeqvdewqelntrwyqfgafvplyrshgqnpyreifniadegtevynamvwytklryyl mpyiytlggdtyhkdg
Timeline for d2xvla3:
![]() Domains from same chain: (mouse over for more information) d2xvla1, d2xvla2, d2xvla4, d2xvla5 |