| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
| Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
| Protein Phosphoglucomutase [55959] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55960] (6 PDB entries) |
| Domain d3pmga4: 3pmg A:421-561 [41301] Other proteins in same PDB: d3pmga1, d3pmga2, d3pmga3, d3pmgb1, d3pmgb2, d3pmgb3 complexed with mg |
PDB Entry: 3pmg (more details), 2.4 Å
SCOPe Domain Sequences for d3pmga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmga4 d.129.2.1 (A:421-561) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
ialkvsqlqertgrtaptvit
Timeline for d3pmga4:
View in 3DDomains from other chains: (mouse over for more information) d3pmgb1, d3pmgb2, d3pmgb3, d3pmgb4 |