| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
| Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
| Protein Phosphoglucomutase [53740] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
| Domain d3pmgb2: 3pmg B:191-303 [35412] Other proteins in same PDB: d3pmga4, d3pmgb4 complexed with mg |
PDB Entry: 3pmg (more details), 2.4 Å
SCOPe Domain Sequences for d3pmgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmgb2 c.84.1.1 (B:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv
Timeline for d3pmgb2:
View in 3DDomains from other chains: (mouse over for more information) d3pmga1, d3pmga2, d3pmga3, d3pmga4 |