![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphoglucomutase [53740] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
![]() | Domain d3pmga1: 3pmg A:1-190 [35408] Other proteins in same PDB: d3pmga4, d3pmgb4 complexed with mg |
PDB Entry: 3pmg (more details), 2.4 Å
SCOPe Domain Sequences for d3pmga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf kpftveivds
Timeline for d3pmga1:
![]() Domains from other chains: (mouse over for more information) d3pmgb1, d3pmgb2, d3pmgb3, d3pmgb4 |