PDB entry 3pmg

View 3pmg on RCSB PDB site
Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity
Class: phosphotransferase
Keywords: phosphoglucomutase, phosphotransferase
Deposited on 1995-03-02, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-d-glucose-1,6-bisphosphate
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pmga1, d3pmga2, d3pmga3, d3pmga4
  • Chain 'B':
    Compound: alpha-d-glucose-1,6-bisphosphate
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pmgb1, d3pmgb2, d3pmgb3, d3pmgb4
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pmgA (A:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pmgB (B:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit