Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
Protein Histone-arginine N-methyltransferase CARM1 [419084] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [419581] (2 PDB entries) |
Domain d2v74b_: 2v74 B: [412946] automated match to d2v7ea_ complexed with sah |
PDB Entry: 2v74 (more details), 2.7 Å
SCOPe Domain Sequences for d2v74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v74b_ c.66.1.6 (B:) Histone-arginine N-methyltransferase CARM1 {Mouse (Mus musculus) [TaxId: 10090]} avqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqa garkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfn ermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsa lrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvh glafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankr qsydisivaqvdqtgskssnlldlknpffry
Timeline for d2v74b_: