Lineage for d2v74f_ (2v74 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892976Protein Histone-arginine N-methyltransferase CARM1 [419084] (1 species)
  7. 2892977Species Mouse (Mus musculus) [TaxId:10090] [419581] (2 PDB entries)
  8. 2892982Domain d2v74f_: 2v74 F: [412948]
    automated match to d2v7ea_
    complexed with sah

Details for d2v74f_

PDB Entry: 2v74 (more details), 2.7 Å

PDB Description: crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), in complex with s-adenosyl-homocysteine
PDB Compounds: (F:) histone-arginine methyltransferase carm1

SCOPe Domain Sequences for d2v74f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v74f_ c.66.1.6 (F:) Histone-arginine N-methyltransferase CARM1 {Mouse (Mus musculus) [TaxId: 10090]}
avqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqa
garkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfn
ermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsa
lrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvh
glafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankr
qsydisivaqvdqtgskssnlldlknpffryt

SCOPe Domain Coordinates for d2v74f_:

Click to download the PDB-style file with coordinates for d2v74f_.
(The format of our PDB-style files is described here.)

Timeline for d2v74f_:

  • d2v74f_ is new in SCOPe 2.08-stable