Lineage for d2v7ea_ (2v7e A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
Protein Histone-arginine N-methyltransferase CARM1 [419084] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [419581] (2 PDB entries) 
Domain d2v7ea_: 2v7e A: [412950]
complexed with hg
Details for d2v7ea_
PDB Entry: 2v7e (more details), 2.7 Å
PDB Description: crystal structure of coactivator-associated arginine methyltransferase 1 (carm1), unliganded
PDB Compounds: (A:) histone-arginine methyltransferase carm1SCOPe Domain Sequences for d2v7ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7ea_ c.66.1.6 (A:) Histone-arginine N-methyltransferase CARM1 {Mouse (Mus musculus) [TaxId: 10090]}
gylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcgsgilsffaaqagarkiyav
eastmaqhaevlvksnnltdrivvipgkveevslpeqvdiiisepmgymlfnermlesyl
hakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwyqpsfhgvdlsalrgaavde
yfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipfkfhmlhsglvhglafwfdv
afigsimtvwlstapteplthwyqvrclfqsplfakagdtlsgtclliankrqsydisiv
aqvdqtgskssnlldlknpffr
SCOPe Domain Coordinates for d2v7ea_:
Click to download the PDB-style file with coordinates for d2v7ea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v7ea_:
- d2v7ea_ is new in SCOPe 2.08-stable
View in 3D
