SCOPe 2.08: Domain d6flah1: 6fla H:9-217

Lineage for d6flah1 (6fla H:9-217)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
Domain d6flah1: 6fla H:9-217 [411129]
Other proteins in same PDB: d6flaa2, d6flab1, d6flab2, d6flag_, d6flah2, d6flai_, d6flal1, d6flal2
automated match to d6shgh_
complexed with cl, gol

Details for d6flah1

PDB Entry: 6fla (more details), 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1

PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d6flah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flah1 b.1.1.1 (H:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aevarpgasvklsckasgytftsywlqwvkqrpgqglewigaiwpgdddtryaqkfqgka
tmtadkssstayiqlsnlasedsavyycarkggfamdywgqgtsvtvssakttppsvypl
apgsgaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d6flah1:

Click to download the PDB-style file with coordinates for d6flah1.
(The format of our PDB-style files is described here.)

Timeline for d6flah1: