Lineage for d6flah1 (6fla H:9-217)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (621 PDB entries)
  8. 2745258Domain d6flah1: 6fla H:9-217 [411129]
    Other proteins in same PDB: d6flaa2, d6flab1, d6flab2, d6flag_, d6flah2, d6flai_, d6flal1, d6flal2
    automated match to d6shgh_
    complexed with cl, gol

Details for d6flah1

PDB Entry: 6fla (more details), 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1
PDB Compounds: (H:) heavy chain

SCOPe Domain Sequences for d6flah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flah1 b.1.1.1 (H:9-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aevarpgasvklsckasgytftsywlqwvkqrpgqglewigaiwpgdddtryaqkfqgka
tmtadkssstayiqlsnlasedsavyycarkggfamdywgqgtsvtvssakttppsvypl
apgsgaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d6flah1:

Click to download the PDB-style file with coordinates for d6flah1.
(The format of our PDB-style files is described here.)

Timeline for d6flah1:

  • d6flah1 is new in SCOPe 2.08-stable