SCOPe 2.08: Domain d6flab2: 6fla B:112-216

Lineage for d6flab2 (6fla B:112-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6flab2: 6fla B:112-216 [359261]
   Other proteins in same PDB: d6flaa1, d6flaa2, d6flab1, d6flag_, d6flah1, d6flah2, d6flai_, d6flal1
   automated match to d1tqbc2
   complexed with cl, gol

Details for d6flab2

PDB Entry: 6fla, 2.9 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 1

PDB Compounds: (B:) Light Chain of 3H5

SCOPe Domain Sequences for d6flab2:

Sequence; same for both SEQRES and ATOM records:

>d6flab2 b.1.1.2 (B:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d6flab2:

• d6flab2 first appeared in SCOPe 2.07