SCOPe 2.08: Domain d6dwih1: 6dwi H:6-217

Lineage for d6dwih1 (6dwi H:6-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6dwih1: 6dwi H:6-217 [411019]
   Other proteins in same PDB: d6dwia1, d6dwia2, d6dwib2, d6dwic1, d6dwic2, d6dwid2, d6dwie1, d6dwie2, d6dwif2, d6dwig1, d6dwig2, d6dwih2, d6dwii1, d6dwii2, d6dwik1, d6dwik2, d6dwim1, d6dwim2, d6dwin2, d6dwio1, d6dwio2, d6dwip2
   automated match to d6shgh_
   complexed with cl, flc, gol, hd4

Details for d6dwih1

PDB Entry: 6dwi, 2.39 Å

PDB Description: structure of the 4462 antibody fab fragment bound to a staphylococcus aureus wall techoic acid analog

PDB Compounds: (H:) 4462 Fab Heavy chain

SCOPe Domain Sequences for d6dwih1:

Sequence, based on SEQRES records:

>d6dwih1 b.1.1.1 (H:6-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsgggleqpggslriscaasgftfntndmswvrqapgkglqwvstiigiddtthyadsvr
grftvsrdtsknmvylqmnslrvedtalyycvknsgiysfwgqgtlvtvssastkgpsvf
plapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d6dwih1 b.1.1.1 (H:6-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsgggleqpggslriscaasgftfntndmswvrqapgkglqwvstiigiddtthyadsvr
grftvsrdtsknmvylqmnslrvedtalyycvknsgiysfwgqgtlvtvssastkgpsvf
plapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpss
slgtqtyicnvnhkpsntkvdkkvepk

Timeline for d6dwih1:

• d6dwih1 is new in SCOPe 2.08-stable