Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6dwig2: 6dwi G:107-211 [357203] Other proteins in same PDB: d6dwia1, d6dwib1, d6dwib2, d6dwic1, d6dwid1, d6dwid2, d6dwie1, d6dwif1, d6dwif2, d6dwig1, d6dwih1, d6dwih2, d6dwii1, d6dwij_, d6dwik1, d6dwil_, d6dwim1, d6dwin1, d6dwin2, d6dwio1, d6dwip1, d6dwip2 automated match to d1dn0a2 complexed with cl, flc, gol, hd4 |
PDB Entry: 6dwi (more details), 2.39 Å
SCOPe Domain Sequences for d6dwig2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dwig2 b.1.1.2 (G:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d6dwig2:
View in 3D Domains from other chains: (mouse over for more information) d6dwia1, d6dwia2, d6dwib1, d6dwib2, d6dwic1, d6dwic2, d6dwid1, d6dwid2, d6dwie1, d6dwie2, d6dwif1, d6dwif2, d6dwih1, d6dwih2, d6dwii1, d6dwii2, d6dwij_, d6dwik1, d6dwik2, d6dwil_, d6dwim1, d6dwim2, d6dwin1, d6dwin2, d6dwio1, d6dwio2, d6dwip1, d6dwip2 |