Lineage for d6dwia1 (6dwi A:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756352Domain d6dwia1: 6dwi A:1-106 [357020]
    Other proteins in same PDB: d6dwia2, d6dwib1, d6dwib2, d6dwic2, d6dwid1, d6dwid2, d6dwie2, d6dwif1, d6dwif2, d6dwig2, d6dwih1, d6dwih2, d6dwii2, d6dwij_, d6dwik2, d6dwil_, d6dwim2, d6dwin1, d6dwin2, d6dwio2, d6dwip1, d6dwip2
    automated match to d1dn0a1
    complexed with cl, flc, gol, hd4

Details for d6dwia1

PDB Entry: 6dwi (more details), 2.39 Å

PDB Description: structure of the 4462 antibody fab fragment bound to a staphylococcus aureus wall techoic acid analog
PDB Compounds: (A:) 4462 Fab Light Chain

SCOPe Domain Sequences for d6dwia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dwia1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspatlsvspgetvtlscrasqsvrtnvawyrhkagqapmilvsgastrasgapa
rfsgsgygteftltitslqsedfavyyclqyntwprtfgqgtkvev

SCOPe Domain Coordinates for d6dwia1:

Click to download the PDB-style file with coordinates for d6dwia1.
(The format of our PDB-style files is described here.)

Timeline for d6dwia1: