Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5gznc_: 5gzn C: [410119] Other proteins in same PDB: d5gzna1, d5gzna2, d5gznb1, d5gznb2, d5gznd1, d5gznd2, d5gznl1, d5gznl2 automated match to d6shgh_ |
PDB Entry: 5gzn (more details), 3 Å
SCOPe Domain Sequences for d5gznc_:
Sequence, based on SEQRES records: (download)
>d5gznc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
>d5gznc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg tlvtvssastkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
Timeline for d5gznc_: