Lineage for d5gznc_ (5gzn C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743597Domain d5gznc_: 5gzn C: [410119]
    Other proteins in same PDB: d5gzna1, d5gzna2, d5gznb1, d5gznb2, d5gznd1, d5gznd2, d5gznl1, d5gznl2
    automated match to d6shgh_

Details for d5gznc_

PDB Entry: 5gzn (more details), 3 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (C:) antibody heavy chain

SCOPe Domain Sequences for d5gznc_:

Sequence, based on SEQRES records: (download)

>d5gznc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg
tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d5gznc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvqpgrslrlscaasgftfssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskstlylqmnnlraedtavyycardhlgwssiwsapesfldywgqg
tlvtvssastkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d5gznc_:

Click to download the PDB-style file with coordinates for d5gznc_.
(The format of our PDB-style files is described here.)

Timeline for d5gznc_:

  • d5gznc_ is new in SCOPe 2.08-stable