Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) |
Family f.10.1.0: automated matches [227258] (1 protein) not a true family |
Protein automated matches [227047] (11 species) not a true protein |
Species Zika virus [TaxId:64320] [317278] (7 PDB entries) |
Domain d5gzna1: 5gzn A:1-303 [327657] Other proteins in same PDB: d5gzna2, d5gznb2, d5gznc_, d5gznd1, d5gznd2, d5gznh_, d5gznl1, d5gznl2 automated match to d4gsxa1 |
PDB Entry: 5gzn (more details), 3 Å
SCOPe Domain Sequences for d5gzna1:
Sequence, based on SEQRES records: (download)
>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl kgv
>d5gzna1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]} ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa cskkmtgksiqpenleyrimlsvhgsqhndtghetdenrakveitpnspraeatlggfgs lgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvef kdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv
Timeline for d5gzna1: