![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Zika virus [TaxId:64320] [317280] (7 PDB entries) |
![]() | Domain d5gznb2: 5gzn B:304-407 [327601] Other proteins in same PDB: d5gzna1, d5gznb1, d5gznc_, d5gznd1, d5gznd2, d5gznh_, d5gznl1, d5gznl2 automated match to d4gsxa2 |
PDB Entry: 5gzn (more details), 3 Å
SCOPe Domain Sequences for d5gznb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gznb2 b.1.18.0 (B:304-407) automated matches {Zika virus [TaxId: 64320]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrsgsti
Timeline for d5gznb2: