SCOPe 2.08: Domain d4r4bd1: 4r4b D:6-214

Lineage for d4r4bd1 (4r4b D:6-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (31 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
Domain d4r4bd1: 4r4b D:6-214 [409506]
Other proteins in same PDB: d4r4ba2, d4r4bb2, d4r4bc2, d4r4bd2, d4r4be2, d4r4bf2, d4r4bh2, d4r4bl2
automated match to d6shgh_
complexed with nag, so4

Details for d4r4bd1

PDB Entry: 4r4b (more details), 2.2 Å

PDB Description: crystal structure of the anti-hiv-1 antibody 2.2c

PDB Compounds: (D:) fab 2.2c heavy chain

SCOPe Domain Sequences for d4r4bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r4bd1 b.1.1.0 (D:6-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwgagllkpsetlsltcgvygeslsghywswvrqppgkrlewigeikhngspnyhpslks
rvtisldmsknqfslnltsvtaadtavyfcarrsnwpylpfdpwgqgtlvtvssastkgp
svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d4r4bd1:

Click to download the PDB-style file with coordinates for d4r4bd1.
(The format of our PDB-style files is described here.)

Timeline for d4r4bd1: