![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4r4bl2: 4r4b L:107-211 [259527] Other proteins in same PDB: d4r4ba1, d4r4bb1, d4r4bb2, d4r4bc1, d4r4bd1, d4r4bd2, d4r4be1, d4r4bf1, d4r4bf2, d4r4bh1, d4r4bh2, d4r4bl1 automated match to d2fjha2 complexed with nag, so4 |
PDB Entry: 4r4b (more details), 2.2 Å
SCOPe Domain Sequences for d4r4bl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r4bl2 b.1.1.2 (L:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d4r4bl2: