![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4r4be1: 4r4b E:1-106 [260582] Other proteins in same PDB: d4r4ba2, d4r4bb2, d4r4bc2, d4r4bd2, d4r4be2, d4r4bf2, d4r4bh2, d4r4bl2 automated match to d2fjha1 complexed with nag, so4 |
PDB Entry: 4r4b (more details), 2.2 Å
SCOPe Domain Sequences for d4r4be1:
Sequence, based on SEQRES records: (download)
>d4r4be1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsfvsasvgdrvtitcrasqgissylawyqqkpgkapklviyaastlqsgvps rfsgsgsgteftltisslqpedfatyycqhliglrsfgqgtklei
>d4r4be1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsfvsasvgdrvtitcrasqgissylawyqqkpgkapklviyaastlrfsgsg sgteftltisslqpedfatyycqhliglrsfgqgtklei
Timeline for d4r4be1: