Lineage for d1a3ab_ (1a3a B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.112: IIA domain of mannitol-specific and ntr phosphotransherase EII [55803] (1 superfamily) Superfamily d.112.1: IIA domain of mannitol-specific and ntr phosphotransherase EII [55804] (1 family) 
Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransherase EII [55805] (2 proteins) Protein Phosphotransferase IIa-mannitol [55808] (1 species) Species Escherichia coli [TaxId:562] [55809] (1 PDB entry) 
Domain d1a3ab_: 1a3a B: [40918]
Details for d1a3ab_
PDB Entry: 1a3a (more details), 1.8 Å
PDB Description: crystal structure of iia mannitol from escherichia coli
SCOP Domain Sequences for d1a3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3ab_ d.112.1.1 (B:) Phosphotransferase IIa-mannitol {Escherichia coli}
fklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiavp
hgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnaldd
esvierlahttsvdevlella
SCOP Domain Coordinates for d1a3ab_:
Click to download the PDB-style file with coordinates for d1a3ab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a3ab_:
- d1a3ab_ appears in SCOP 1.57
- d1a3ab_ appears in the current release, SCOPe 2.08
View in 3D
