Lineage for d1a3ad_ (1a3a D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35282Fold d.112: IIA domain of mannitol-specific and ntr phosphotransherase EII [55803] (1 superfamily)
  4. 35283Superfamily d.112.1: IIA domain of mannitol-specific and ntr phosphotransherase EII [55804] (1 family) (S)
  5. 35284Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransherase EII [55805] (2 proteins)
  6. 35289Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 35290Species Escherichia coli [TaxId:562] [55809] (1 PDB entry)
  8. 35294Domain d1a3ad_: 1a3a D: [40920]

Details for d1a3ad_

PDB Entry: 1a3a (more details), 1.8 Å

PDB Description: crystal structure of iia mannitol from escherichia coli

SCOP Domain Sequences for d1a3ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ad_ d.112.1.1 (D:) Phosphotransferase IIa-mannitol {Escherichia coli}
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr

SCOP Domain Coordinates for d1a3ad_:

Click to download the PDB-style file with coordinates for d1a3ad_.
(The format of our PDB-style files is described here.)

Timeline for d1a3ad_: