| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (2 proteins) |
| Protein Destrin [55767] (1 species) |
| Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries) |
| Domain d1ak7__: 1ak7 - [40864] |
PDB Entry: 1ak7 (more details)
SCOP Domain Sequences for d1ak7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak7__ d.109.1.2 (-) Destrin {Human and pig (Homo sapiens) and (Sus scrofa)}
tmitpssgnsasgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciivee
gkeilvgdvgvtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelapl
kskmiyasskdaikkkfqgikhecqangpedlnraciaeklggslivafegcpv
Timeline for d1ak7__: