Lineage for d1ak7__ (1ak7 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35183Family d.109.1.2: Cofilin-like [55762] (2 proteins)
  6. 35195Protein Destrin [55767] (1 species)
  7. 35196Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries)
  8. 35197Domain d1ak7__: 1ak7 - [40864]

Details for d1ak7__

PDB Entry: 1ak7 (more details)

PDB Description: destrin, nmr, 20 structures

SCOP Domain Sequences for d1ak7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak7__ d.109.1.2 (-) Destrin {Human and pig (Homo sapiens) and (Sus scrofa)}
tmitpssgnsasgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciivee
gkeilvgdvgvtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelapl
kskmiyasskdaikkkfqgikhecqangpedlnraciaeklggslivafegcpv

SCOP Domain Coordinates for d1ak7__:

Click to download the PDB-style file with coordinates for d1ak7__.
(The format of our PDB-style files is described here.)

Timeline for d1ak7__: