![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein Destrin [55767] (1 species) |
![]() | Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries) identical sequence in both species |
![]() | Domain d1ak7a1: 1ak7 A:2-165 [40864] Other proteins in same PDB: d1ak7a2 |
PDB Entry: 1ak7 (more details)
SCOPe Domain Sequences for d1ak7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak7a1 d.109.1.2 (A:2-165) Destrin {Human and pig (Homo sapiens) and (Sus scrofa) [TaxId: 9606]} asgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciiveegkeilvgdvg vtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelaplkskmiyassk daikkkfqgikhecqangpedlnraciaeklggslivafegcpv
Timeline for d1ak7a1: