Lineage for d1ak7a1 (1ak7 A:2-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969863Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2969902Protein Destrin [55767] (1 species)
  7. 2969903Species Human and pig (Homo sapiens) and (Sus scrofa) [TaxId:9606] [55768] (2 PDB entries)
    identical sequence in both species
  8. 2969904Domain d1ak7a1: 1ak7 A:2-165 [40864]
    Other proteins in same PDB: d1ak7a2

Details for d1ak7a1

PDB Entry: 1ak7 (more details)

PDB Description: destrin, nmr, 20 structures
PDB Compounds: (A:) destrin

SCOPe Domain Sequences for d1ak7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak7a1 d.109.1.2 (A:2-165) Destrin {Human and pig (Homo sapiens) and (Sus scrofa) [TaxId: 9606]}
asgvqvadevcrifydmkvrkcstpeeikkrkkavifclsadkkciiveegkeilvgdvg
vtitdpfkhfvgmlpekdcryalydasfetkesrkeelmfflwapelaplkskmiyassk
daikkkfqgikhecqangpedlnraciaeklggslivafegcpv

SCOPe Domain Coordinates for d1ak7a1:

Click to download the PDB-style file with coordinates for d1ak7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ak7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ak7a2