| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
| Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
| Protein suc1 [55639] (1 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries) in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12 |
| Domain d1puc__: 1puc - [40675] complexed with cps |
PDB Entry: 1puc (more details), 1.95 Å
SCOP Domain Sequences for d1puc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1puc__ d.97.1.1 (-) suc1 {Fission yeast (Schizosaccharomyces pombe)}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekd
Timeline for d1puc__: